2DS8
Structure of the zbd-xb complex
PDB DOI: 10.2210/pdb2ds8/pdb
Classification: METAL BINDING PROTEIN, PROTEIN BINDING Organism(s): Escherichia Coli , Synthetic Construct
Deposited: 2006-06-22 Deposition Author(s): Hong, S.B. , Kim, H.W. , Lee, B.G. , Park, E.Y. , Song, H.K.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.6 Å
Structure of the zbd-xb complex
Hong, S.B. , Kim, H.W. , Lee, B.G. , Park, E.Y. , Song, H.K.
Primary Citation of Related Structures: 2DS8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ATP-dependent Clp protease ATP-binding subunit clpX | A | 51 | Escherichia Coli , Synthetic Construct | TDKRKDGSGKLLYCSFCGKSQHEVRKLIAGPSVYICDECVDLCNDIIREEI |
| ATP-dependent Clp protease ATP-binding subunit clpX | B | 51 | Escherichia Coli , Synthetic Construct | TDKRKDGSGKLLYCSFCGKSQHEVRKLIAGPSVYICDECVDLCNDIIREEI |
| SspB-tail peptide | P | 8 | Escherichia Coli , Synthetic Construct | APALRVVK |
| SspB-tail peptide | Q | 8 | Escherichia Coli , Synthetic Construct | APALRVVK |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2006-06-22 Deposition Author(s): Hong, S.B. , Kim, H.W. , Lee, B.G. , Park, E.Y. , Song, H.K.