Solution structure of rsgi ruh-058, a lipoyl domain of human 2-oxoacid dehydrogenase
PDB DOI: 10.2210/pdb2dne/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens
Deposited: 2006-04-26 Deposition Author(s): Hayashi, F. , Hirota, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Ruhul Momen, A.Z.M. , Yokoyama, S.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of rsgi ruh-058, a lipoyl domain of human 2-oxoacid dehydrogenase
Hayashi, F. , Hirota, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Ruhul Momen, A.Z.M. , Yokoyama, S.
Primary Citation of Related Structures: 2DNE
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | A | 108 | Homo Sapiens | GSSGSSGQKVPLPSLSPTMQAGTIARWEKKEGDKINEGDLIAEVETDKATVGFESLEECYMAKILVAEGTRDVPIGAIICITVGKPEDIEAFKNYTLDSSAASGPSSG |
Method: SOLUTION NMR
Deposited Date: 2006-04-26 Deposition Author(s): Hayashi, F. , Hirota, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Ruhul Momen, A.Z.M. , Yokoyama, S.