Solution structure of ww domain in ww domain binding protein 4 (wbp-4)
PDB DOI: 10.2210/pdb2dk1/pdb
Classification: GENE REGULATION Organism(s): Salmonella Enterica
Deposited: 2006-04-06 Deposition Author(s): He, F. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
Solution structure of ww domain in ww domain binding protein 4 (wbp-4)
He, F. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
Primary Citation of Related Structures: 2DK1
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
WW domain-binding protein 4 | A | 50 | Salmonella Enterica | GSSGSSGRWVEGITSEGYHYYYDLISGASQWEKPEGFQGDLKKTSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2006-04-06 Deposition Author(s): He, F. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.