One sequence two fold ? : miss fold of the zf-b-box domain from human tripartite motif protein 39
PDB DOI: 10.2210/pdb2dif/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica
Deposited: 2006-03-29 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tomizawa, T. , Yokoyama, S.
One sequence two fold ? : miss fold of the zf-b-box domain from human tripartite motif protein 39
Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tomizawa, T. , Yokoyama, S.
Primary Citation of Related Structures: 2DIF
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Tripartite motif protein 39 | A | 53 | Salmonella Enterica | GSSGSSGESLCPQHHEALSLFCYEDQEAVCLICAISHTHRAHTVVPLSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2006-03-29 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tomizawa, T. , Yokoyama, S.