Solution structure of the second uba domain in the human ubiquitin specific protease 5 (isopeptidase 5)
PDB DOI: 10.2210/pdb2dak/pdb
Classification: HYDROLASE Organism(s): Salmonella Enterica
Deposited: 2005-12-14 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Yokoyama, S. , Zhao, C.
Solution structure of the second uba domain in the human ubiquitin specific protease 5 (isopeptidase 5)
Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Yokoyama, S. , Zhao, C.
Primary Citation of Related Structures: 2DAK
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Ubiquitin carboxyl-terminal hydrolase 5 | A | 63 | Salmonella Enterica | GSSGSSGPPEDCVTTIVSMGFSRDQALKALRATNNSLERAVDWIFSHIDDLDAEAAMSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-12-14 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Yokoyama, S. , Zhao, C.