Solution structure of the novel identified ubiquitin-like domain in the human cobl-like 1 protein
PDB DOI: 10.2210/pdb2daj/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Homo Sapiens
Deposited: 2005-12-14 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Yokoyama, S. , Zhao, C.
Solution structure of the novel identified ubiquitin-like domain in the human cobl-like 1 protein
Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Yokoyama, S. , Zhao, C.
Primary Citation of Related Structures: 2DAJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| KIAA0977 protein | A | 91 | Homo Sapiens | GSSGSSGEKTVRVVINFKKTQKTIVRVSPHASLQELAPIICSKCEFDPLHTLLLKDYQSQEPLDLTKSLNDLGLRELYAMDVNRESGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-12-14 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Yokoyama, S. , Zhao, C.