Solution structure of rsgi ruh-049, a uba domain from mouse cdna
PDB DOI: 10.2210/pdb2d9s/pdb
Classification: LIGASE Organism(s): Enterobacter Aerogenes
Deposited: 2005-12-13 Deposition Author(s): Guntert, P. , Hamada, T. , Hirota, H. , Izumi, K. , Kigawa, T. , Koshiba, S. , Kurosaki, C. , Lin, Y.-J. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M.
Solution structure of rsgi ruh-049, a uba domain from mouse cdna
Guntert, P. , Hamada, T. , Hirota, H. , Izumi, K. , Kigawa, T. , Koshiba, S. , Kurosaki, C. , Lin, Y.-J. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M.
Primary Citation of Related Structures: 2D9S
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
CBL E3 ubiquitin protein ligase | A | 53 | Enterobacter Aerogenes | GSSGSSGQLSSEIERLMSQGYSYQDIQKALVIAHNNIEMAKNILREFSGPSSG |
CBL E3 ubiquitin protein ligase | B | 53 | Enterobacter Aerogenes | GSSGSSGQLSSEIERLMSQGYSYQDIQKALVIAHNNIEMAKNILREFSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-12-13 Deposition Author(s): Guntert, P. , Hamada, T. , Hirota, H. , Izumi, K. , Kigawa, T. , Koshiba, S. , Kurosaki, C. , Lin, Y.-J. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M.