Solution structure of ccch type zinc-finger domain 2 in cleavage and polyadenylation specificity factor
PDB DOI: 10.2210/pdb2d9n/pdb
Classification: RNA BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2005-12-12 Deposition Author(s): Abe, C. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
Solution structure of ccch type zinc-finger domain 2 in cleavage and polyadenylation specificity factor
Abe, C. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
Primary Citation of Related Structures: 2D9N
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence | 
| Cleavage and polyadenylation specificity factor, 30 kDa subunit | A | 77 | Homo Sapiens | GSSGSSGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWSGPSSG | 
Method: SOLUTION NMR
Deposited Date: 2005-12-12 Deposition Author(s): Abe, C. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
 
                  