Solution structure of the bromodomain of peregrin
PDB DOI: 10.2210/pdb2d9e/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2005-12-09 Deposition Author(s): Hatta, R. , Hayashi, F. , Izumi, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M.
Solution structure of the bromodomain of peregrin
Hatta, R. , Hayashi, F. , Izumi, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M.
Primary Citation of Related Structures: 2D9E
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peregrin | A | 121 | Homo Sapiens | GSSGSSGFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMGSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-12-09 Deposition Author(s): Hatta, R. , Hayashi, F. , Izumi, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M.