Solution structure of rsgi ruh-048, a gtf2i domain in human cdna
PDB DOI: 10.2210/pdb2d99/pdb
Classification: TRANSCRIPTION Organism(s): Salmonella Enterica
Deposited: 2005-12-09 Deposition Author(s): Doi-Katayama, Y. , Hirota, H. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Yokoyama, S.
Solution structure of rsgi ruh-048, a gtf2i domain in human cdna
Doi-Katayama, Y. , Hirota, H. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Yokoyama, S.
Primary Citation of Related Structures: 2D99
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
General transcription factor II-I repeat domain-containing protein 1 | A | 90 | Salmonella Enterica | GSSGSSGLRKMVEEVFDVLYSEALGRASVVPLPYERLLREPGLLAVQGLPEGLAFRRPAEYDPKALMAILEHSHRIRFKLKRPSSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-12-09 Deposition Author(s): Doi-Katayama, Y. , Hirota, H. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Yokoyama, S.