Structure of chorismate mutase (form i) from thermus thermophilus hb8
PDB DOI: 10.2210/pdb2d8d/pdb
Classification: ISOMERASE Organism(s): Scytalidium Thermophilum
Deposited: 2005-12-02 Deposition Author(s): Bagautdinov, B. , Kunishima, N. , Riken Structural Genomics/Proteomics Initiative (Rsgi)
Structure of chorismate mutase (form i) from thermus thermophilus hb8
Bagautdinov, B. , Kunishima, N. , Riken Structural Genomics/Proteomics Initiative (Rsgi)
Primary Citation of Related Structures: 2D8D
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
phospho-2-dehydro-3-deoxyheptonate aldolase/chorismate mutase | A | 90 | Scytalidium Thermophilum | MDERIQALRKEVDRVNREILRLLSERGRLVQEIGRLQTELGLPHYDPKREEEMLAYLTAENPGPFPDETIRKLFKEIFKASLDLEERQDQ |
phospho-2-dehydro-3-deoxyheptonate aldolase/chorismate mutase | B | 90 | Scytalidium Thermophilum | MDERIQALRKEVDRVNREILRLLSERGRLVQEIGRLQTELGLPHYDPKREEEMLAYLTAENPGPFPDETIRKLFKEIFKASLDLEERQDQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-12-02 Deposition Author(s): Bagautdinov, B. , Kunishima, N. , Riken Structural Genomics/Proteomics Initiative (Rsgi)