Target structure-based discovery of small molecules that block human p53 and creb binding protein (cbp) association
PDB DOI: 10.2210/pdb2d82/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens
Deposited: 2005-12-01 Deposition Author(s): Liu, W.J. , Manfredi, J.J. , Mujtaba, S. , Resnick-Silverman, L. , Sachchidanand , Yan, S. , Zeng, L. , Zhou, M.M.
Target structure-based discovery of small molecules that block human p53 and creb binding protein (cbp) association
Liu, W.J. , Manfredi, J.J. , Mujtaba, S. , Resnick-Silverman, L. , Sachchidanand , Yan, S. , Zeng, L. , Zhou, M.M.
Primary Citation of Related Structures: 2D82
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| CREB-binding protein | A | 121 | Homo Sapiens | GSHMRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG |
Method: SOLUTION NMR
Deposited Date: 2005-12-01 Deposition Author(s): Liu, W.J. , Manfredi, J.J. , Mujtaba, S. , Resnick-Silverman, L. , Sachchidanand , Yan, S. , Zeng, L. , Zhou, M.M.