Solution structure of the hmg box domain from human wd repeat and hmg-box dna binding protein 1
PDB DOI: 10.2210/pdb2d7l/pdb
Classification: GENE REGULATION, DNA BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2005-11-24 Deposition Author(s): Inoue, M. , Kamatari, Y.O. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Tomizawa, T. , Yokoyama, S.
Solution structure of the hmg box domain from human wd repeat and hmg-box dna binding protein 1
Inoue, M. , Kamatari, Y.O. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Tomizawa, T. , Yokoyama, S.
Primary Citation of Related Structures: 2D7L
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| WD repeat and HMG-box DNA binding protein 1 | A | 81 | Homo Sapiens | GSSGSSGRPKTGFQMWLEENRSNILSDNPDFSDEADIIKEGMIRFRVLSTEERKVWANKAKGETASEGTEAKKRKSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-11-24 Deposition Author(s): Inoue, M. , Kamatari, Y.O. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Tomizawa, T. , Yokoyama, S.