Crystal structure of the interleukin-4 variant t13d
PDB DOI: 10.2210/pdb2d48/pdb
Classification: CYTOKINE Organism(s): Homo Sapiens
Deposited: 2005-10-11 Deposition Author(s): Harrer, H. , Klein, M. , Kraich, M. , Mueller, T.D. , Patino, E. , Sebald, W.
Crystal structure of the interleukin-4 variant t13d
Harrer, H. , Klein, M. , Kraich, M. , Mueller, T.D. , Patino, E. , Sebald, W.
Primary Citation of Related Structures: 2D48
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Interleukin-4 | A | 129 | Homo Sapiens | HKCDITLQEIIKDLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-10-11 Deposition Author(s): Harrer, H. , Klein, M. , Kraich, M. , Mueller, T.D. , Patino, E. , Sebald, W.