Solution structure of the nrsf/rest-msin3b pah1 complex
PDB DOI: 10.2210/pdb2czy/pdb
Classification: GENE REGULATION Organism(s): Mus Musculus , Synthetic Construct
Deposited: 2005-07-20 Deposition Author(s): Mori, N. , Murai, K. , Nishimura, Y. , Nomura, M. , Uda-Tochio, H.
Solution structure of the nrsf/rest-msin3b pah1 complex
Mori, N. , Murai, K. , Nishimura, Y. , Nomura, M. , Uda-Tochio, H.
Primary Citation of Related Structures: 2CZY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Paired amphipathic helix protein Sin3b | A | 77 | Mus Musculus , Synthetic Construct | PVHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPLGYRIDIPK |
| transcription factor REST (version 3) | B | 15 | Mus Musculus , Synthetic Construct | APQLIMLANVALTGE |
Method: SOLUTION NMR
Deposited Date: 2005-07-20 Deposition Author(s): Mori, N. , Murai, K. , Nishimura, Y. , Nomura, M. , Uda-Tochio, H.