Crystallization and x-ray structure determination of cytochrome c2 from rhodobacter sphaeroides in three crystal forms
PDB DOI: 10.2210/pdb2cxb/pdb
Classification: ELECTRON TRANSPORT (CYTOCHROME) Organism(s): Rhodobacter Sphaeroides
Deposited: 1994-04-21 Deposition Author(s): Allen, J.P. , Axelrod, H.L. , Chirino, A.J. , Day, M.W. , Feher, G. , Hsu, B.T. , Rees, D.C.
Crystallization and x-ray structure determination of cytochrome c2 from rhodobacter sphaeroides in three crystal forms
Allen, J.P. , Axelrod, H.L. , Chirino, A.J. , Day, M.W. , Feher, G. , Hsu, B.T. , Rees, D.C.
Primary Citation of Related Structures: 2CXB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| CYTOCHROME C2 | A | 124 | Rhodobacter Sphaeroides | QEGDPEAGAKAFNQCQTCHVIVDDSGTTIAGRNAKTGPNLYGVVGRTAGTQADFKGYGEGMKEAGAKGLAWDEEHFVQYVQDPTKFLKEYTGDAKAKGKMTFKLKKEADAHNIWAYLQQVAVRP |
| CYTOCHROME C2 | B | 124 | Rhodobacter Sphaeroides | QEGDPEAGAKAFNQCQTCHVIVDDSGTTIAGRNAKTGPNLYGVVGRTAGTQADFKGYGEGMKEAGAKGLAWDEEHFVQYVQDPTKFLKEYTGDAKAKGKMTFKLKKEADAHNIWAYLQQVAVRP |
Method: X-RAY DIFFRACTION
Deposited Date: 1994-04-21 Deposition Author(s): Allen, J.P. , Axelrod, H.L. , Chirino, A.J. , Day, M.W. , Feher, G. , Hsu, B.T. , Rees, D.C.