Crystal structure of nucleotide diphosphate kinase from pyrococcus horikoshii
PDB DOI: 10.2210/pdb2cwk/pdb
Classification: TRANSFERASE Organism(s): Pyrococcus Horikoshii
Deposited: 2005-06-21 Deposition Author(s): Kato-Murayama, M. , Murayama, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Yokoyama, S.
Crystal structure of nucleotide diphosphate kinase from pyrococcus horikoshii
Kato-Murayama, M. , Murayama, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Yokoyama, S.
Primary Citation of Related Structures: 2CWK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| nucleoside-diphosphate kinase | A | 160 | Pyrococcus Horikoshii | MFQMSETERTLVIIKPDAVVRGLIGEIISRFEKKGLKIVGMKMIWIDRELAEKHYEEHREKPFFKALIDYITKTPVVVMVLEGRYAVEVVRKMAGATDPKDAAPGTIRGDFGLEVSDAICNVIHASDSKESAEREISLFFKPEELFEYPRAADWFYKKGI |
| nucleoside-diphosphate kinase | B | 160 | Pyrococcus Horikoshii | MFQMSETERTLVIIKPDAVVRGLIGEIISRFEKKGLKIVGMKMIWIDRELAEKHYEEHREKPFFKALIDYITKTPVVVMVLEGRYAVEVVRKMAGATDPKDAAPGTIRGDFGLEVSDAICNVIHASDSKESAEREISLFFKPEELFEYPRAADWFYKKGI |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-06-21 Deposition Author(s): Kato-Murayama, M. , Murayama, K. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Yokoyama, S.