2CRC
Solution structure of the zf-ranbp domain of the protein hbv associated factor
PDB DOI: 10.2210/pdb2crc/pdb
Classification: LIGASE Organism(s): Homo Sapiens
Deposited: 2005-05-20 Deposition Author(s): Hayashi, F. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Zhang, H.P.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the zf-ranbp domain of the protein hbv associated factor
Hayashi, F. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Zhang, H.P.
Primary Citation of Related Structures: 2CRC
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ubiquitin conjugating enzyme 7 interacting protein 3 | A | 52 | Homo Sapiens | GSSGSSGPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQVPASYQPSGPSSG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2005-05-20 Deposition Author(s): Hayashi, F. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Zhang, H.P.