Solution structure of the zf-ranbp domain of the protein hbv associated factor
PDB DOI: 10.2210/pdb2crc/pdb
Classification: LIGASE Organism(s): Salmonella Enterica
Deposited: 2005-05-20 Deposition Author(s): Hayashi, F. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Zhang, H.P.
Solution structure of the zf-ranbp domain of the protein hbv associated factor
Hayashi, F. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Zhang, H.P.
Primary Citation of Related Structures: 2CRC
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Ubiquitin conjugating enzyme 7 interacting protein 3 | A | 52 | Salmonella Enterica | GSSGSSGPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQVPASYQPSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-05-20 Deposition Author(s): Hayashi, F. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Zhang, H.P.