Solution structure of the c-terminal rna recognition motif of hypothetical rna-binding protein rbm19
PDB DOI: 10.2210/pdb2cph/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Mus Musculus
Deposited: 2005-05-19 Deposition Author(s): Inoue, M. , Kigawa, T. , Muto, Y. , Nagata, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
Solution structure of the c-terminal rna recognition motif of hypothetical rna-binding protein rbm19
Inoue, M. , Kigawa, T. , Muto, Y. , Nagata, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
Primary Citation of Related Structures: 2CPH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| RNA binding motif protein 19 | A | 107 | Mus Musculus | GSSGSSGQVPKKQTTSKILVRNIPFQANQREIRELFSTFGELKTVRLPKKMTGTGAHRGFGFVDFITKQDAKKAFNALCHSTHLYGRRLVLEWADSEVTVQSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-05-19 Deposition Author(s): Inoue, M. , Kigawa, T. , Muto, Y. , Nagata, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.