Structure of the progesterone receptor-dna complex
PDB DOI: 10.2210/pdb2c7a/pdb
Classification: RECEPTOR/DNA Organism(s): Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2005-11-19 Deposition Author(s): Churchill, M.E.A. , Donham, D.C. , Edwards, D.P. , Pon, V.H. , Roemer, S.C. , Sherman, L.
Structure of the progesterone receptor-dna complex
Churchill, M.E.A. , Donham, D.C. , Edwards, D.P. , Pon, V.H. , Roemer, S.C. , Sherman, L.
Primary Citation of Related Structures: 2C7A
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
PROGESTERONE RECEPTOR | A | 78 | Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFK |
PROGESTERONE RECEPTOR | B | 78 | Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFK |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-11-19 Deposition Author(s): Churchill, M.E.A. , Donham, D.C. , Edwards, D.P. , Pon, V.H. , Roemer, S.C. , Sherman, L.