Crystal structure of basic fibroblast growth factor at 1.6 angstroms resolution
PDB DOI: 10.2210/pdb2bfh/pdb
Classification: GROWTH FACTOR Organism(s): Homo Sapiens
Deposited: 1993-08-31 Deposition Author(s): Ago, H. , Fujishima, A. , Katsube, Y. , Kitagawa, Y. , Matsuura, Y.
Crystal structure of basic fibroblast growth factor at 1.6 angstroms resolution
Ago, H. , Fujishima, A. , Katsube, Y. , Kitagawa, Y. , Matsuura, Y.
Primary Citation of Related Structures: 2BFH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| BASIC FIBROBLAST GROWTH FACTOR | A | 128 | Homo Sapiens | DPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Method: X-RAY DIFFRACTION
Deposited Date: 1993-08-31 Deposition Author(s): Ago, H. , Fujishima, A. , Katsube, Y. , Kitagawa, Y. , Matsuura, Y.