Nmr solution structure of the tsr domain of malaria trap protein
PDB DOI: 10.2210/pdb2bbx/pdb
Classification: CELL ADHESION Organism(s): Plasmodium Falciparum
Deposited: 2005-10-18 Deposition Author(s): Kilpelainen, I. , Permi, P. , Tossavainen, H.
Nmr solution structure of the tsr domain of malaria trap protein
Kilpelainen, I. , Permi, P. , Tossavainen, H.
Primary Citation of Related Structures: 2BBX
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Thrombospondin-related anonymous protein | A | 49 | Plasmodium Falciparum | GSASCGVWDEWSPCSVTCGKGTRSRKREILHEGCTSEIQEQCEEERCPP |
Method: SOLUTION NMR
Deposited Date: 2005-10-18 Deposition Author(s): Kilpelainen, I. , Permi, P. , Tossavainen, H.