Solution structure of the hset2/hypb sri domain
PDB DOI: 10.2210/pdb2a7o/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2005-07-05 Deposition Author(s): Greenleaf, A. , Guan, Z. , Li, M. , Phatnani, H.P. , Sage, H. , Zhou, P.
Solution structure of the hset2/hypb sri domain
Greenleaf, A. , Guan, Z. , Li, M. , Phatnani, H.P. , Sage, H. , Zhou, P.
Primary Citation of Related Structures: 2A7O
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Huntingtin interacting protein B | A | 112 | Homo Sapiens | GSHMTAEADTSSELAKKSKEVFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIKKYMQKFGAVYKPKEDTELE |
Method: SOLUTION NMR
Deposited Date: 2005-07-05 Deposition Author(s): Greenleaf, A. , Guan, Z. , Li, M. , Phatnani, H.P. , Sage, H. , Zhou, P.