Crystal structure analysis of the anti-arsonate germline antibody 36-65 in complex with a phage display derived dodecapeptide klasipthtspl
PDB DOI: 10.2210/pdb2a6i/pdb
Classification: IMMUNE SYSTEM Organism(s): Mus Musculus , Synthetic Construct
Deposited: 2005-07-02 Deposition Author(s): Agarwal, A. , Manivel, V. , Rao, K.V. , Salunke, D.M. , Sethi, D.K.
Crystal structure analysis of the anti-arsonate germline antibody 36-65 in complex with a phage display derived dodecapeptide klasipthtspl
Agarwal, A. , Manivel, V. , Rao, K.V. , Salunke, D.M. , Sethi, D.K.
Primary Citation of Related Structures: 2A6I
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Germline antibody 36-65 Fab light chain | A | 214 | Mus Musculus , Synthetic Construct | DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC |
| Germline antibody 36-65 Fab heavy chain | B | 222 | Mus Musculus , Synthetic Construct | EVQLQQSGAELVRAGSSVKMSCKASGYTFTSYGINWVKQRPGQGLEWIGYINPGNGYTKYNEKFKGKTTLTVDKSSSTAYMQLRSLTSEDSAVYFCARSVYYGGSYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRD |
| Dodecapeptide: KLASIPTHTSPL | P | 12 | Mus Musculus , Synthetic Construct | KLASIPTHTSPL |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-07-02 Deposition Author(s): Agarwal, A. , Manivel, V. , Rao, K.V. , Salunke, D.M. , Sethi, D.K.