Solution structure of the two n-terminal ccp modules of c4b-binding protein (c4bp) alpha-chain.
PDB DOI: 10.2210/pdb2a55/pdb
Classification: IMMUNE SYSTEM Organism(s): Homo Sapiens
Deposited: 2005-06-30 Deposition Author(s): Ball, G. , Barlow, P.N. , Blom, A.M. , Jenkins, H.T. , Lindahl, G. , Mark, L. , Uhrin, D.
Solution structure of the two n-terminal ccp modules of c4b-binding protein (c4bp) alpha-chain.
Ball, G. , Barlow, P.N. , Blom, A.M. , Jenkins, H.T. , Lindahl, G. , Mark, L. , Uhrin, D.
Primary Citation of Related Structures: 2A55
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| C4b-binding protein | A | 133 | Homo Sapiens | MNCGPPPTLSFAAPMDITLTETRFKTGTTLKYTCLPGYVRSHSTQTLTCNSDGEWVYNTFCIYKRCRHPGELRNGQVEIKTDLSFGSQIEFSCSEGFFLIGSTTSRCEVQDRGVGWSHPLPQCEILEHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2005-06-30 Deposition Author(s): Ball, G. , Barlow, P.N. , Blom, A.M. , Jenkins, H.T. , Lindahl, G. , Mark, L. , Uhrin, D.