Advanced Search:
2A4J
Solution structure of the c-terminal domain (t94-y172) of the human centrin 2 in complex with a 17 residues peptide (p1-xpc) from xeroderma pigmentosum group c protein
PDB DOI: 10.2210/pdb2a4j/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2005-06-29 Deposition Author(s): Blouquit, Y. , Craescu, C.T. , Duchambon, P. , Miron, S. , Mouawad, L. , Yang, A.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the c-terminal domain (t94-y172) of the human centrin 2 in complex with a 17 residues peptide (p1-xpc) from xeroderma pigmentosum group c protein
Blouquit, Y. , Craescu, C.T. , Duchambon, P. , Miron, S. , Mouawad, L. , Yang, A.
Primary Citation of Related Structures: 2A4J
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Centrin 2 | A | 79 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | TQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY |
| 17-mer peptide P1-XPC from DNA-repair protein complementing XP-C cells | B | 17 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | NWKLLAKGLLIRERLKR |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2005-06-29 Deposition Author(s): Blouquit, Y. , Craescu, C.T. , Duchambon, P. , Miron, S. , Mouawad, L. , Yang, A.