Crystal structure of enterovirus a71 2a protease mutant c110a containing vp1-2a junction in the active site determined via sulfur phasing
PDB DOI: 10.2210/pdb29mw/pdb
Classification: VIRAL PROTEIN Organism(s): Enterovirus A71
Deposited: 2026-03-24 Deposition Author(s): Aschenbrenner, J.C. , Balcomb, B.H. , Chandran, A.V. , Chinn, C.A. , Cooper, M.R. , Duman, R. , Ebrahim, A. , Fairhead, M. , Keates, T. , Koekemoer, L. , Marples, P.G. , Ni, X. , Openbind Consortium , Shotton, E.J. , Von Delft, F. , Wagner, A. , Wang, S. , Williams, E.
Crystal structure of enterovirus a71 2a protease mutant c110a containing vp1-2a junction in the active site determined via sulfur phasing
Aschenbrenner, J.C. , Balcomb, B.H. , Chandran, A.V. , Chinn, C.A. , Cooper, M.R. , Duman, R. , Ebrahim, A. , Fairhead, M. , Keates, T. , Koekemoer, L. , Marples, P.G. , Ni, X. , Openbind Consortium , Shotton, E.J. , Von Delft, F. , Wagner, A. , Wang, S. , Williams, E.
Primary Citation of Related Structures: 29MW
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Polyprotein | A | 155 | Enterovirus A71 | ITTLGKFGQQSGAIYVGNFRVVNRHLATHNDWANLVWEDSSRDLLVSSTTAQGCDTIARCNCQTGVYYCNSMRKHYPVSFSKPSLIFVEASEYYPARYQSHLMLAVGHSEPGDAGGILRCQHGVVGIVSTGGNGLVGFADVRDLLWLDDEAMEQQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2026-03-24 Deposition Author(s): Aschenbrenner, J.C. , Balcomb, B.H. , Chandran, A.V. , Chinn, C.A. , Cooper, M.R. , Duman, R. , Ebrahim, A. , Fairhead, M. , Keates, T. , Koekemoer, L. , Marples, P.G. , Ni, X. , Openbind Consortium , Shotton, E.J. , Von Delft, F. , Wagner, A. , Wang, S. , Williams, E.