Sfx crystal structure of insulin aspart
PDB DOI: 10.2210/pdb25hf/pdb
Classification: HORMONE Organism(s): Homo Sapiens
Deposited: 2026-04-02 Deposition Author(s): Ayan, E. , Shankar, M.K.
Sfx crystal structure of insulin aspart
Primary Citation of Related Structures: 25HF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Insulin A chain | A | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
| Insulin A chain | C | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
| Insulin B chain | B | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCGERGFFYTDKT |
| Insulin B chain | D | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCGERGFFYTDKT |
Method: X-RAY DIFFRACTION
Deposited Date: 2026-04-02 Deposition Author(s): Ayan, E. , Shankar, M.K.