Crystal structure of a cupin protein (tm1459, presequence-truncated h52a mutant) soaked in cuso4
PDB DOI: 10.2210/pdb21ek/pdb
Classification: METAL BINDING PROTEIN Organism(s): Thermotoga Maritima (Strain Atcc 43589 / Dsm 3109 / Jcm 10099 / Nbrc 100826 / Msb8)
Deposited: 2025-12-10 Deposition Author(s): Fujieda, N. , Matsumoto, R. , Morikawa, S. , Morita, Y. , Saegusa, N.
Crystal structure of a cupin protein (tm1459, presequence-truncated h52a mutant) soaked in cuso4
Fujieda, N. , Matsumoto, R. , Morikawa, S. , Morita, Y. , Saegusa, N.
Primary Citation of Related Structures: 21EK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cupin type-2 domain-containing protein | A | 114 | Thermotoga Maritima (Strain Atcc 43589 / Dsm 3109 / Jcm 10099 / Nbrc 100826 / Msb8) | MILKRAYDVTPQKISTDKVRGVRKRVLIGLKDAPNFVMRLFTVEPGGLIDRASHPWEHEIFVLKGKLTVLKEQGEETVEEGFYIFVEPNEIHGFRNDTDSEVEFLCLIPKEGGE |
Method: X-RAY DIFFRACTION
Deposited Date: 2025-12-10 Deposition Author(s): Fujieda, N. , Matsumoto, R. , Morikawa, S. , Morita, Y. , Saegusa, N.