Structure of bovine parathyroid hormone fragment 1-37, nmr, 10 structures
PDB DOI: 10.2210/pdb1zwc/pdb
Classification: HORMONE Organism(s): Bos Taurus
Deposited: 1996-06-17 Deposition Author(s): Marx, U.C. , Roesch, P.
Structure of bovine parathyroid hormone fragment 1-37, nmr, 10 structures
Primary Citation of Related Structures: 1ZWC
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PARATHYROID HORMONE | A | 37 | Bos Taurus | AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNFVAL |
Method: SOLUTION NMR
Deposited Date: 1996-06-17 Deposition Author(s): Marx, U.C. , Roesch, P.