Yeast bbc1 sh3 domain complexed with a peptide from las17
PDB DOI: 10.2210/pdb1zuk/pdb
Classification: CONTRACTILE PROTEIN Organism(s): Saccharomyces Cerevisiae , Synthetic Construct
Deposited: 2005-05-31 Deposition Author(s): Kursula, I. , Kursula, P. , Lehmann, F. , Song, Y.H. , Wilmanns, M. , Zou, P.
Yeast bbc1 sh3 domain complexed with a peptide from las17
Kursula, I. , Kursula, P. , Lehmann, F. , Song, Y.H. , Wilmanns, M. , Zou, P.
Primary Citation of Related Structures: 1ZUK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Myosin tail region-interacting protein MTI1 | A | 68 | Saccharomyces Cerevisiae , Synthetic Construct | MSEPEVPFKVVAQFPYKSDYEDDLNFEKDQEIIVTSVEDAEWYFGEYQDSNGDVIEGIFPKSFVAVQG |
| Myosin tail region-interacting protein MTI1 | B | 68 | Saccharomyces Cerevisiae , Synthetic Construct | MSEPEVPFKVVAQFPYKSDYEDDLNFEKDQEIIVTSVEDAEWYFGEYQDSNGDVIEGIFPKSFVAVQG |
| Proline-rich protein LAS17 | C | 11 | Saccharomyces Cerevisiae , Synthetic Construct | RGPAPPPPPHR |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-05-31 Deposition Author(s): Kursula, I. , Kursula, P. , Lehmann, F. , Song, Y.H. , Wilmanns, M. , Zou, P.