1ZSG
Beta pix-sh3 complexed with an atypical peptide from alpha-pak
PDB DOI: 10.2210/pdb1zsg/pdb
Classification: TRANSFERASE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2005-05-24 Deposition Author(s): Evetts, K.A. , Mott, H.R. , Nietlispach, D. , Owen, D.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Beta pix-sh3 complexed with an atypical peptide from alpha-pak
Evetts, K.A. , Mott, H.R. , Nietlispach, D. , Owen, D.
Primary Citation of Related Structures: 1ZSG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Rho guanine nucleotide exchange factor 7 | A | 65 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKA |
| Serine/threonine-protein kinase PAK 1 | B | 22 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | DATPPPVIAPRPEHTKSVYTRS |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2005-05-24 Deposition Author(s): Evetts, K.A. , Mott, H.R. , Nietlispach, D. , Owen, D.