Solution structure of the first ww domain of fbp11
PDB DOI: 10.2210/pdb1zr7/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens
Deposited: 2005-05-19 Deposition Author(s): Hino, Y. , Kato, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tanokura, M.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the first ww domain of fbp11
Hino, Y. , Kato, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tanokura, M.
Primary Citation of Related Structures: 1ZR7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| huntingtin-interacting protein HYPA/FBP11 | A | 30 | Homo Sapiens | GSWTEHKSPDGRTYYYNTETKQSTWEKPDD |
Method: SOLUTION NMR
Deposited Date: 2005-05-19 Deposition Author(s): Hino, Y. , Kato, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tanokura, M.