Nmr solution structure of the bicoid homeodomain bound to the consensus dna binding site taatcc
PDB DOI: 10.2210/pdb1zq3/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Drosophila Melanogaster , Synthetic Construct
Deposited: 2005-05-18 Deposition Author(s): Baird-Titus, J.M. , Clark-Baldwin, K. , Ma, J. , Rance, M. , Vrushank, D.
Nmr solution structure of the bicoid homeodomain bound to the consensus dna binding site taatcc
Baird-Titus, J.M. , Clark-Baldwin, K. , Ma, J. , Rance, M. , Vrushank, D.
Primary Citation of Related Structures: 1ZQ3
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Homeotic bicoid protein | P | 68 | Drosophila Melanogaster , Synthetic Construct | GPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQS |
Method: SOLUTION NMR
Deposited Date: 2005-05-18 Deposition Author(s): Baird-Titus, J.M. , Clark-Baldwin, K. , Ma, J. , Rance, M. , Vrushank, D.