Nmr solution structure of the bicoid homeodomain bound to the consensus dna binding site taatcc
PDB DOI: 10.2210/pdb1zq3/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2005-05-18 Deposition Author(s): Baird-Titus, J.M. , Clark-Baldwin, K. , Ma, J. , Rance, M. , Vrushank, D.
Method: SOLUTION NMR Resolution: N.A.
Nmr solution structure of the bicoid homeodomain bound to the consensus dna binding site taatcc
Baird-Titus, J.M. , Clark-Baldwin, K. , Ma, J. , Rance, M. , Vrushank, D.
Primary Citation of Related Structures: 1ZQ3
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Homeotic bicoid protein | P | 68 | Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQS |
Method: SOLUTION NMR
Deposited Date: 2005-05-18 Deposition Author(s): Baird-Titus, J.M. , Clark-Baldwin, K. , Ma, J. , Rance, M. , Vrushank, D.