Crystal structure of the reduced form of mycobacterium tuberculosis guanylate kinase in complex with gdp
PDB DOI: 10.2210/pdb1znz/pdb
Classification: TRANSFERASE Organism(s): Mycobacterium Tuberculosis
Deposited: 2005-05-12 Deposition Author(s): Cherfils, J. , Christova, P. , Girard, E. , Hible, G. , Munier-Lehmann, H. , Renault, L. , Seclaman, E. , Thompson, A.
Crystal structure of the reduced form of mycobacterium tuberculosis guanylate kinase in complex with gdp
Cherfils, J. , Christova, P. , Girard, E. , Hible, G. , Munier-Lehmann, H. , Renault, L. , Seclaman, E. , Thompson, A.
Primary Citation of Related Structures: 1ZNZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Guanylate kinase | A | 207 | Mycobacterium Tuberculosis | SVGEGPDTKPTARGQPAAVGRVVVLSGPSAVGKSTVVRCLRERIPNLHFSVSATTRAPRPGEVDGVDYHFIDPTRFQQLIDQGELLEWAEIHGGLHRSGTLAQPVRAAAATGVPVLIEVDLAGARAIKKTMPEAVTVFLAPPSWQDLQARLIGRGTETADVIQRRLDTARIELAAQGDFDKVVVNRRLESACAELVSLLVGTAPGSP |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-05-12 Deposition Author(s): Cherfils, J. , Christova, P. , Girard, E. , Hible, G. , Munier-Lehmann, H. , Renault, L. , Seclaman, E. , Thompson, A.