Gcn4-leucine zipper core mutant asn16aba in the trimeric state
PDB DOI: 10.2210/pdb1zij/pdb
Classification: LEUCINE ZIPPER Organism(s): Saccharomyces Cerevisiae
Deposited: 1996-10-30 Deposition Author(s): Alber, T. , Brown, R.A. , Gonzalez Junior, L. , Richardson, D.
Gcn4-leucine zipper core mutant asn16aba in the trimeric state
Alber, T. , Brown, R.A. , Gonzalez Junior, L. , Richardson, D.
Primary Citation of Related Structures: 1ZIJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| GENERAL CONTROL PROTEIN GCN4 | A | 34 | Saccharomyces Cerevisiae | XRMKQLEDKVEELLSKAYHLENEVARLKKLVGER |
| GENERAL CONTROL PROTEIN GCN4 | B | 34 | Saccharomyces Cerevisiae | XRMKQLEDKVEELLSKAYHLENEVARLKKLVGER |
| GENERAL CONTROL PROTEIN GCN4 | C | 34 | Saccharomyces Cerevisiae | XRMKQLEDKVEELLSKAYHLENEVARLKKLVGER |
Method: X-RAY DIFFRACTION
Deposited Date: 1996-10-30 Deposition Author(s): Alber, T. , Brown, R.A. , Gonzalez Junior, L. , Richardson, D.