Ufd1 exhibits the aaa-atpase fold with two distinct ubiquitin interaction sites
PDB DOI: 10.2210/pdb1zc1/pdb
Classification: PROTEIN TURNOVER Organism(s): Saccharomyces Cerevisiae
Deposited: 2005-04-10 Deposition Author(s): Isaacson, R. , Kim, H.T. , Park, S. , Silver, P.A. , Wagner, G.
Ufd1 exhibits the aaa-atpase fold with two distinct ubiquitin interaction sites
Isaacson, R. , Kim, H.T. , Park, S. , Silver, P.A. , Wagner, G.
Primary Citation of Related Structures: 1ZC1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ubiquitin fusion degradation protein 1 | A | 208 | Saccharomyces Cerevisiae | MFSGFSSFGGGNGFVNMPQTFEEFFRCYPIAMMNDRIRKDDANFGGKIFLPPSALSKLSMLNIRYPMLFKLTANETGRVTHGGVLEFIAEEGRVYLPQWMMETLGIQPGSLLQISSTDVPLGQFVKLEPQSVDFLDISDPKAVLENVLRNFSTLTVDDVIEISYNGKTFKIKILEVKPESSSKSICVIETDLVTDFAPPVGYVEPDYK |
Method: SOLUTION NMR
Deposited Date: 2005-04-10 Deposition Author(s): Isaacson, R. , Kim, H.T. , Park, S. , Silver, P.A. , Wagner, G.