Solution structure of crotamine, a myotoxin from crotalus durissus terrificus
PDB DOI: 10.2210/pdb1z99/pdb
Classification: TOXIN Organism(s): Crotalus Durissus Terrificus
Deposited: 2005-04-01 Deposition Author(s): Bettendorff, P. , De Azevedo, W.F. , Fadel, V. , Herrmann, T. , Oliveira, E.B. , Wuthrich, K. , Yamane, T.
Solution structure of crotamine, a myotoxin from crotalus durissus terrificus
Bettendorff, P. , De Azevedo, W.F. , Fadel, V. , Herrmann, T. , Oliveira, E.B. , Wuthrich, K. , Yamane, T.
Primary Citation of Related Structures: 1Z99
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Crotamine | A | 42 | Crotalus Durissus Terrificus | YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG |
Method: SOLUTION NMR
Deposited Date: 2005-04-01 Deposition Author(s): Bettendorff, P. , De Azevedo, W.F. , Fadel, V. , Herrmann, T. , Oliveira, E.B. , Wuthrich, K. , Yamane, T.