The solution structure of the n-domain of the transcription factor abrb
PDB DOI: 10.2210/pdb1ysf/pdb
Classification: TRANSCRIPTION Organism(s): Tomato Spotted Wilt Virus (Strain Bulgarian L3)
Deposited: 2005-02-08 Deposition Author(s): Coles, M. , Djuranovic, S. , Truffault, V.
Method: SOLUTION NMR Resolution: N.A.
The solution structure of the n-domain of the transcription factor abrb
Coles, M. , Djuranovic, S. , Truffault, V.
Primary Citation of Related Structures: 1YSF
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Transition state regulatory protein abrB | A | 59 | Tomato Spotted Wilt Virus (Strain Bulgarian L3) | MHHHHHHFMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPN |
Transition state regulatory protein abrB | B | 59 | Tomato Spotted Wilt Virus (Strain Bulgarian L3) | MHHHHHHFMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPN |
Method: SOLUTION NMR
Deposited Date: 2005-02-08 Deposition Author(s): Coles, M. , Djuranovic, S. , Truffault, V.