E. coli ispf double mutant
PDB DOI: 10.2210/pdb1yqn/pdb
Classification: LYASE Organism(s): Escherichia Coli
Deposited: 2005-02-02 Deposition Author(s): Hunter, W.N. , Kemp, L.E. , Ramsden, N. , Sgraja, T.
E. coli ispf double mutant
Hunter, W.N. , Kemp, L.E. , Ramsden, N. , Sgraja, T.
Primary Citation of Related Structures: 1YQN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence | 
| 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | A | 161 | Escherichia Coli | AEMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGMGLGIACEAVALLIKATK | 
Method: X-RAY DIFFRACTION
Deposited Date: 2005-02-02 Deposition Author(s): Hunter, W.N. , Kemp, L.E. , Ramsden, N. , Sgraja, T.
 
                  