Solution structure of the pelle death domain
PDB DOI: 10.2210/pdb1ygo/pdb
Classification: TRANSFERASE Organism(s): Drosophila Melanogaster
Deposited: 2005-01-05 Deposition Author(s): Gay, N.J. , Moncrieffe, M.C. , Stott, K.M.
Solution structure of the pelle death domain
Gay, N.J. , Moncrieffe, M.C. , Stott, K.M.
Primary Citation of Related Structures: 1YGO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Probable serine/threonine-protein kinase pelle | A | 110 | Drosophila Melanogaster | GSHMSHLDNTMAIRLLPLPVRAQLCAHLDALDVWQQLATAVKLYPDQVEQISSQKQRGRSASNEFLNIWGGQYNHTVQTLFALFKKLKLHNAMRLIKDYVSEDLHKYIPR |
Method: SOLUTION NMR
Deposited Date: 2005-01-05 Deposition Author(s): Gay, N.J. , Moncrieffe, M.C. , Stott, K.M.