The solution structure of the n-domain of the transcription factor abrb
PDB DOI: 10.2210/pdb1yfb/pdb
Classification: TRANSCRIPTION Organism(s): Bacillus Subtilis
Deposited: 2004-12-31 Deposition Author(s): Coles, M. , Djuranovic, S. , Truffault, V.
The solution structure of the n-domain of the transcription factor abrb
Coles, M. , Djuranovic, S. , Truffault, V.
Primary Citation of Related Structures: 1YFB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transition state regulatory protein abrB | A | 59 | Bacillus Subtilis | MHHHHHHFMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPN |
| Transition state regulatory protein abrB | B | 59 | Bacillus Subtilis | MHHHHHHFMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPN |
Method: SOLUTION NMR
Deposited Date: 2004-12-31 Deposition Author(s): Coles, M. , Djuranovic, S. , Truffault, V.