Crystal structure of a type iii secretion system protein complexed with the lipid, 1-monohexanoyl-2-hydroxy-sn-glycero-3-phosphate
PDB DOI: 10.2210/pdb1y9t/pdb
Classification: LIPID BINDING PROTEIN Organism(s): Shigella Flexneri
Deposited: 2004-12-16 Deposition Author(s): Lario, P.I. , Strynadka, N.C.
Crystal structure of a type iii secretion system protein complexed with the lipid, 1-monohexanoyl-2-hydroxy-sn-glycero-3-phosphate
Primary Citation of Related Structures: 1Y9T
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Lipoprotein mxiM | A | 115 | Shigella Flexneri | SSSNSEKEWHIVPVSKDYFSIPNDLLWSFNTTNKSINVYSKCISGKAVYSFNAGKFMGNFNVKEVDGCFMDAQKIAIDKLFSMLKDGVVLKGNKINDTILIEKDGEVKLKLIRGI |
Method: X-RAY DIFFRACTION
Deposited Date: 2004-12-16 Deposition Author(s): Lario, P.I. , Strynadka, N.C.