Zinc fingers as protein recognition motifs: structural basis for the gata-1/friend of gata interaction
PDB DOI: 10.2210/pdb1y0j/pdb
Classification: DNA BINDING PROTEIN Organism(s): Drosophila Melanogaster , Mus Musculus
Deposited: 2004-11-15 Deposition Author(s): Crofts, L.A. , Crossley, M. , Kwan, A.H.Y. , Liew, C.K. , Loughlin, F.E. , Mackay, J.P. , Matthews, J.M. , Simpson, R.J.Y.
Zinc fingers as protein recognition motifs: structural basis for the gata-1/friend of gata interaction
Crofts, L.A. , Crossley, M. , Kwan, A.H.Y. , Liew, C.K. , Loughlin, F.E. , Mackay, J.P. , Matthews, J.M. , Simpson, R.J.Y.
Primary Citation of Related Structures: 1Y0J
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence | 
| Erythroid transcription factor | A | 46 | Drosophila Melanogaster , Mus Musculus | GSEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRPLIR | 
| Zinc-finger protein ush | B | 36 | Drosophila Melanogaster , Mus Musculus | GSLLKPARFMCLPCGIAFSSPSTLEAHQAYYCSHRI | 
Method: SOLUTION NMR
Deposited Date: 2004-11-15 Deposition Author(s): Crofts, L.A. , Crossley, M. , Kwan, A.H.Y. , Liew, C.K. , Loughlin, F.E. , Mackay, J.P. , Matthews, J.M. , Simpson, R.J.Y.