High resolution crystal structure of phycoerythrin 545 from the marine cryptophyte rhodomonas cs24
PDB DOI: 10.2210/pdb1xf6/pdb
Classification: PHOTOSYNTHESIS Organism(s): Rhodomonas Sp. Cs24
Deposited: 2004-09-14 Deposition Author(s): Curmi, P.M.G. , Doust, A.B. , Harrop, S.J. , Marai, C.N.J. , Scholes, G.D. , Wilk, K.E.
High resolution crystal structure of phycoerythrin 545 from the marine cryptophyte rhodomonas cs24
Curmi, P.M.G. , Doust, A.B. , Harrop, S.J. , Marai, C.N.J. , Scholes, G.D. , Wilk, K.E.
Primary Citation of Related Structures: 1XF6
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Phycoerythrin alpha-3 chain | A | 76 | Rhodomonas Sp. Cs24 | AMDKSAKAPQITIFDHRGCSRAPKESTGGKAGGQDDEMMVKVASTKVTVSESDAAKKLQEFITFEKGIDGPFTSKN |
| Phycoerythrin alpha-2 chain | B | 67 | Rhodomonas Sp. Cs24 | AMDKSAKAPVITIFDHRGCSRAPKEYTGAKAGGKDDEMMVKAQSVKIEVSTGTAEGVLATSLAKMTK |
| B-phycoerythrin beta chain | C | 177 | Rhodomonas Sp. Cs24 | MLDAFSRVVTNADSKAAYVGGADLQALKKFISEGNKRLDSVNSIVSNASCIVSDAVSGMICENPSLISPSGNCYTNRRMAACLRDGEIILRYVSYALLSGDASVLEDRCLNGLKETYSSLGVPANSNARAVSIMKACAVAFVNNTASQKKLSTPQGDCSGLASEVGGYFDKVTAAIS |
| B-phycoerythrin beta chain | D | 177 | Rhodomonas Sp. Cs24 | MLDAFSRVVTNADSKAAYVGGADLQALKKFISEGNKRLDSVNSIVSNASCIVSDAVSGMICENPSLISPSGNCYTNRRMAACLRDGEIILRYVSYALLSGDASVLEDRCLNGLKETYSSLGVPANSNARAVSIMKACAVAFVNNTASQKKLSTPQGDCSGLASEVGGYFDKVTAAIS |
Method: X-RAY DIFFRACTION
Deposited Date: 2004-09-14 Deposition Author(s): Curmi, P.M.G. , Doust, A.B. , Harrop, S.J. , Marai, C.N.J. , Scholes, G.D. , Wilk, K.E.