Structure of the hexapeptide xenobiotic acetyltransferase from pseudomonas aeruginosa
PDB DOI: 10.2210/pdb1xat/pdb
Classification: ACETYLTRANSFERASE Organism(s): Pseudomonas Aeruginosa
Deposited: 1998-03-11 Deposition Author(s): Beaman, T.W. , Roderick, S.L. , Sugantino, M.
Structure of the hexapeptide xenobiotic acetyltransferase from pseudomonas aeruginosa
Beaman, T.W. , Roderick, S.L. , Sugantino, M.
Primary Citation of Related Structures: 1XAT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| XENOBIOTIC ACETYLTRANSFERASE | A | 212 | Pseudomonas Aeruginosa | MGNYFESPFRGKLLSEQVSNPNIRVGRYSYYSGYYHGHSFDDCARYLMPDRDDVDKLVIGSFCSIGSGAAFIMAGNQGHRAEWASTFPFHFMHEEPAFAGAVNGYQPAGDTLIGHEVWIGTEAMFMPGVRVGHGAIIGSRALVTGDVEPYAIVGGNPARTIRKRFSDGDIQNLLEMAWWDWPLADIEAAMPLLCTGDIPALYQHWKQRQATA |
Method: X-RAY DIFFRACTION
Deposited Date: 1998-03-11 Deposition Author(s): Beaman, T.W. , Roderick, S.L. , Sugantino, M.