Solution nmr structure of protein ta0354 from thermoplasma acidophilum. ontario center for structural proteomics target ta0354_69_121; northeast structural genomics consortium target tat38.
PDB DOI: 10.2210/pdb1x9b/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Achromobacter Denitrificans
Deposited: 2004-08-20 Deposition Author(s): Arrowsmith, C.H. , Edward, A. , Huang, Y.J. , Kennedy, M. , Lemak, A. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Ontario Centre For Structural Proteomics (Ocsp) , Ramelot, T.A. , Semesi, A. , Wu, B. , Yee, A.
Solution nmr structure of protein ta0354 from thermoplasma acidophilum. ontario center for structural proteomics target ta0354_69_121; northeast structural genomics consortium target tat38.
Arrowsmith, C.H. , Edward, A. , Huang, Y.J. , Kennedy, M. , Lemak, A. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Ontario Centre For Structural Proteomics (Ocsp) , Ramelot, T.A. , Semesi, A. , Wu, B. , Yee, A.
Primary Citation of Related Structures: 1X9B
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
hypothetical membrane protein ta0354_69_121 | A | 53 | Achromobacter Denitrificans | RNLSDRAKFESMINSPSKSVFVRNLNELEALAVRLGKSYRIQLDQAKEKWKVK |
Method: SOLUTION NMR
Deposited Date: 2004-08-20 Deposition Author(s): Arrowsmith, C.H. , Edward, A. , Huang, Y.J. , Kennedy, M. , Lemak, A. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Ontario Centre For Structural Proteomics (Ocsp) , Ramelot, T.A. , Semesi, A. , Wu, B. , Yee, A.