0.85 a crystal structure of nitrophorin 4 from rhodnius prolixus complexed with ammonia at ph 7.4
PDB DOI: 10.2210/pdb1x8p/pdb
Classification: LIGAND BINDING PROTEIN Organism(s): Rhodnius Prolixus
Deposited: 2004-08-18 Deposition Author(s): Kondrashov, D.A. , Montfort, W.R. , Roberts, S.A. , Weichsel, A.
0.85 a crystal structure of nitrophorin 4 from rhodnius prolixus complexed with ammonia at ph 7.4
Kondrashov, D.A. , Montfort, W.R. , Roberts, S.A. , Weichsel, A.
Primary Citation of Related Structures: 1X8P
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Nitrophorin 4 | A | 184 | Rhodnius Prolixus | ACTKNAIAQTGFNKDKYFNGDVWYVTDYLDLEPDDVPKRYCAALAAGTASGKLKEALYHYDPKTQDTFYDVSELQVESLGKYTANFKKVDKNGNVKVAVTAGNYYTFTVMYADDSSALIHTCLHKGNKDLGDLYAVLNRNKDAAAGDKVKSAVSAATLEFSKFISTKENNCAYDNDSLKSLLTK |
Method: X-RAY DIFFRACTION
Deposited Date: 2004-08-18 Deposition Author(s): Kondrashov, D.A. , Montfort, W.R. , Roberts, S.A. , Weichsel, A.